vmatch
large scale sequence analysis software
Command lineScience
Not tested on a device yet. What that means
Commands in the package
vmatchchain2dimmatchclustermkdna6idxmkvtreevendianvmatchselectvseqinfovseqselectvstree2texvsubseqselect
About vmatch
From Debian's package description
Vmatch is a versatile software tool for efficiently solving large scale sequence matching tasks. It subsumes the software tool REPuter, but is much more general, with a very flexible user interface, and improved space and time requirements.
From Debian's description of the vmatch package, under that package's license.
Dependencies
Depends on
libc6zlib1g
Related apps
- hmmerprofile hidden Markov models for protein sequence analysisCommand line
- hmmer2profile hidden Markov models for protein sequence analysisCommand line
- last-aligngenome-scale comparison of biological sequencesCommand line
- seergenomic sequence element (kmer) enrichment analysisCommand line
- seqan-appsC++ library for the analysis of biological sequencesCommand line
- Clustal XGlobal multiple nucleotide or peptide sequence alignment and phylogenetic analysis
Sources and licenses
- Name: the Debian package name.
- Summary: Debian's short description of the vmatch package, under that package's license.
- Description: Debian's description of the vmatch package, under that package's license.
- Versions and sizes: Debian's archive for ARM64, as on packages.debian.org.
- Popularity: Debian Popularity Contest counts.
More in About the catalog.